Lineage for d3bp9o_ (3bp9 O:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739496Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1739497Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1739498Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1739499Protein AKV capsid [116949] (2 species)
  7. 1739507Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry)
  8. 1739522Domain d3bp9o_: 3bp9 O: [172755]
    automated match to d1u7ka_
    complexed with gol, ipa

Details for d3bp9o_

PDB Entry: 3bp9 (more details), 2.6 Å

PDB Description: Structure of B-tropic MLV capsid N-terminal domain
PDB Compounds: (O:) gag protein

SCOPe Domain Sequences for d3bp9o_:

Sequence, based on SEQRES records: (download)

>d3bp9o_ a.73.1.1 (O:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq
lllaglqnagr

Sequence, based on observed residues (ATOM records): (download)

>d3bp9o_ a.73.1.1 (O:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrllqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllgtlltg
eekqrvllearkavqlpnevdaafplerpdwdytttegrnhlvlyrqlllaglqnagr

SCOPe Domain Coordinates for d3bp9o_:

Click to download the PDB-style file with coordinates for d3bp9o_.
(The format of our PDB-style files is described here.)

Timeline for d3bp9o_: