Lineage for d3bp3b_ (3bp3 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1213440Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1213441Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 1213442Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 1213443Protein Glucose permease domain IIB [55606] (1 species)
  7. 1213444Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
    there are differences in secondary structure packing between the two NMR-determined structures
  8. 1213446Domain d3bp3b_: 3bp3 B: [172737]
    automated match to d1ibaa_
    complexed with so4

Details for d3bp3b_

PDB Entry: 3bp3 (more details), 1.65 Å

PDB Description: Crystal structure of EIIB
PDB Compounds: (B:) Glucose-specific phosphotransferase enzyme IIB component

SCOPe Domain Sequences for d3bp3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp3b_ d.95.1.1 (B:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
qaifgtksdnlktemdeyirn

SCOPe Domain Coordinates for d3bp3b_:

Click to download the PDB-style file with coordinates for d3bp3b_.
(The format of our PDB-style files is described here.)

Timeline for d3bp3b_: