Lineage for d3bp3a_ (3bp3 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662475Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1662476Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 1662477Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 1662478Protein Glucose permease domain IIB [55606] (1 species)
  7. 1662479Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
    there are differences in secondary structure packing between the two NMR-determined structures
  8. 1662480Domain d3bp3a_: 3bp3 A: [172736]
    automated match to d1ibaa_
    complexed with so4

Details for d3bp3a_

PDB Entry: 3bp3 (more details), 1.65 Å

PDB Description: Crystal structure of EIIB
PDB Compounds: (A:) Glucose-specific phosphotransferase enzyme IIB component

SCOPe Domain Sequences for d3bp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp3a_ d.95.1.1 (A:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
qaifgtksdnlktemdeyirn

SCOPe Domain Coordinates for d3bp3a_:

Click to download the PDB-style file with coordinates for d3bp3a_.
(The format of our PDB-style files is described here.)

Timeline for d3bp3a_: