Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins) |
Protein automated matches [190618] (1 species) not a true protein |
Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries) |
Domain d3bnyd_: 3bny D: [172727] automated match to d1dgpa_ complexed with bme, cl, fpf, mg |
PDB Entry: 3bny (more details), 1.89 Å
SCOPe Domain Sequences for d3bnyd_:
Sequence, based on SEQRES records: (download)
>d3bnyd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]} slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm glklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqea dvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqtt lrysv
>d3bnyd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]} slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm glklspselqrvreidancskhlsvvndiysyekelytsklctsvqilaqeadvtaeaak rvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv
Timeline for d3bnyd_: