Lineage for d3bk3a_ (3bk3 A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461830Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 1461850Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species)
  7. 1461851Species Human (Homo sapiens) [TaxId:9606] [57517] (10 PDB entries)
  8. 1461862Domain d3bk3a_: 3bk3 A: [172677]
    automated match to d3bmpa_

Details for d3bk3a_

PDB Entry: 3bk3 (more details), 2.7 Å

PDB Description: crystal structure of the complex of bmp-2 and the first von willebrand domain type c of crossveinless-2
PDB Compounds: (A:) Bone morphogenetic protein 2

SCOPe Domain Sequences for d3bk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bk3a_ g.17.1.2 (A:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]}
kssckrhplyvdfsdvgwndwivappgyhamychgecpfpladhlnstnhaivqtlvnsv
nskipkaccvptelsaismlmldenekvvlknyqdmvvegcgcr

SCOPe Domain Coordinates for d3bk3a_:

Click to download the PDB-style file with coordinates for d3bk3a_.
(The format of our PDB-style files is described here.)

Timeline for d3bk3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bk3b_