PDB entry 3bk3

View 3bk3 on RCSB PDB site
Description: Crystal structure of the complex of BMP-2 and the first Von Willebrand domain type C of Crossveinless-2
Class: Hormone/growth Factor
Keywords: TGF-beta superfamily, BMP modulator proteins, Chordin, BMP inhibitor, Chondrogenesis, Cleavage on pair of basic residues, Cytokine, Developmental protein, Differentiation, Glycoprotein, Growth factor, Osteogenesis, Polymorphism, Secreted, Hormone/growth Factor COMPLEX
Deposited on 2007-12-05, released 2008-05-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 2
    Species: HOMO SAPIENS
    Gene: BMP2, BMP2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12643 (Start-113)
      • engineered (40)
      • engineered (90)
    Domains in SCOPe 2.03: d3bk3a_
  • Chain 'B':
    Compound: Bone morphogenetic protein 2
    Species: HOMO SAPIENS
    Gene: BMP2, BMP2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12643 (Start-113)
      • engineered (40)
      • engineered (90)
    Domains in SCOPe 2.03: d3bk3b_
  • Chain 'C':
    Compound: Crossveinless 2
    Species: Danio rerio
    Gene: crossveinless-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5D734 (1-66)
      • expression tag (0)
  • Chain 'D':
    Compound: Crossveinless 2
    Species: Danio rerio
    Gene: crossveinless-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5D734 (1-66)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3bk3A (A:)
qakhkqrkrlkssckrhplyvdfsdvgwndwivappgyhamychgecpfpladhlnstnh
aivqtlvnsvnskipkaccvptelsaismlmldenekvvlknyqdmvvegcgcr

    Sequence, based on observed residues (ATOM records): (download) 
    >3bk3A (A:)
kssckrhplyvdfsdvgwndwivappgyhamychgecpfpladhlnstnhaivqtlvnsv
nskipkaccvptelsaismlmldenekvvlknyqdmvvegcgcr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3bk3B (B:)
qakhkqrkrlkssckrhplyvdfsdvgwndwivappgyhamychgecpfpladhlnstnh
aivqtlvnsvnskipkaccvptelsaismlmldenekvvlknyqdmvvegcgcr

    Sequence, based on observed residues (ATOM records): (download) 
    >3bk3B (B:)
kssckrhplyvdfsdvgwndwivappgyhamychgecpfpladhlnstnhaivqtlvnsv
nskipkaccvptelsaismlmldenekvvlknyqdmvvegcgcr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.