Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (18 PDB entries) |
Domain d3bewe_: 3bew E: [172579] automated match to d1hlam_ |
PDB Entry: 3bew (more details), 2.6 Å
SCOPe Domain Sequences for d3bewe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bewe_ b.1.1.0 (E:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw tfqrlvhadftpssgstyackvehetlkepqvykwdpef
Timeline for d3bewe_: