SCOPe 2.03: Domain d3bcpa_: 3bcp A:

Lineage for d3bcpa_ (3bcp A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (16 PDB entries)
   Uniprot P00669 27-150

8. Domain d3bcpa_: 3bcp A: [172542]
   automated match to d1y94a_

Details for d3bcpa_

PDB Entry: 3bcp, 2.57 Å

PDB Description: crystal structure of the swapped non covalent form of p19a/l28q/n67d bs-rnase

PDB Compounds: (A:) Seminal ribonuclease

SCOPe Domain Sequences for d3bcpa_:

Sequence; same for both SEQRES and ATOM records:

>d3bcpa_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnsassssnycnqmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d3bcpa_:

• d3bcpa_ first appeared in SCOPe 2.01
  
• d3bcpa_ appears in SCOPe 2.02
  
• d3bcpa_ appears in SCOPe 2.04
  
• d3bcpa_ appears in the current release, SCOPe 2.08