SCOPe 2.05: Domain d3balb_: 3bal B:

Lineage for d3balb_ (3bal B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.21: Acetylacetone-cleaving enzyme-like [159293] (2 proteins)
   PfamB PB026844

6. Protein automated matches [190885] (1 species)
   not a true protein

7. Species Acinetobacter johnsonii [TaxId:40214] [188275] (1 PDB entry)

8. Domain d3balb_: 3bal B: [172520]
   automated match to d2o1qa1
   complexed with zn

Details for d3balb_

PDB Entry: 3bal, 1.95 Å

PDB Description: crystal structure of an acetylacetone dioxygenase from acinetobacter johnsonii

PDB Compounds: (B:) Acetylacetone-cleaving enzyme

SCOPe Domain Sequences for d3balb_:

Sequence; same for both SEQRES and ATOM records:

>d3balb_ b.82.1.21 (B:) automated matches {Acinetobacter johnsonii [TaxId: 40214]}
mdycnkkhtaeeyvkisdnnyvpfpeafsdggitwqllhsspetsswtaifncpagssfa
shihagpgeyfltkgkmevrggeqeggstayapsygfessgalhgktffpvesqfymtfl
gplnfiddngkviasigwaeaqgawlatk

Timeline for d3balb_:

• d3balb_ first appeared in SCOPe 2.01
  
• d3balb_ appears in SCOPe 2.04
  
• d3balb_ appears in SCOPe 2.06
  
• d3balb_ appears in the current release, SCOPe 2.08