Lineage for d1tcfa_ (1tcf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997314Protein Troponin C [47503] (6 species)
  7. 1997372Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries)
  8. 1997375Domain d1tcfa_: 1tcf A: [17250]
    calcium-saturated form
    complexed with ca

Details for d1tcfa_

PDB Entry: 1tcf (more details), 1.9 Å

PDB Description: crystal structure of calcium-saturated rabbit skeletal troponin c
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1tcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcfa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmeg

SCOPe Domain Coordinates for d1tcfa_:

Click to download the PDB-style file with coordinates for d1tcfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tcfa_: