| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
| Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
| Protein Odorant binding protein LUSH [101190] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries) |
| Domain d3b86a_: 3b86 A: [172487] automated match to d1oofa_ complexed with act, eoh, pg4 |
PDB Entry: 3b86 (more details), 2 Å
SCOPe Domain Sequences for d3b86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b86a_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagsvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp
Timeline for d3b86a_: