Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (21 PDB entries) |
Domain d3b84a_: 3b84 A: [172486] automated match to d1r28a_ complexed with edo, unk |
PDB Entry: 3b84 (more details), 1.74 Å
SCOPe Domain Sequences for d3b84a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b84a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msfvqhsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqslygdgsggs vvlpagfaeifgllldffytghlaltsgnrdqvllaarelrvpeavelcqsfk
Timeline for d3b84a_: