![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [187826] (18 PDB entries) |
![]() | Domain d3b7pb_: 3b7p B: [172471] automated match to d1xj5a_ complexed with mta, spm |
PDB Entry: 3b7p (more details), 2 Å
SCOPe Domain Sequences for d3b7pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7pb_ c.66.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg ltkpnkkleskefadlkyynyenhsaafklpafllkeien
Timeline for d3b7pb_: