Lineage for d5tnc__ (5tnc -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442704Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 442946Protein Troponin C [47503] (6 species)
  7. 442996Species Turkey (Meleagris gallopavo) [TaxId:9103] [47505] (2 PDB entries)
  8. 442997Domain d5tnc__: 5tnc - [17246]

Details for d5tnc__

PDB Entry: 5tnc (more details), 2 Å

PDB Description: refined crystal structure of troponin c from turkey skeletal muscle at 2.0 angstroms resolution

SCOP Domain Sequences for d5tnc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tnc__ a.39.1.5 (-) Troponin C {Turkey (Meleagris gallopavo)}
smtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldai
ieevdedgsgtidfeeflvmmvrqmkedakgkseeeledcfrifdknadgfidieelgei
lratgehvteediedlmkdsdknndgridfdeflkmmegvq

SCOP Domain Coordinates for d5tnc__:

Click to download the PDB-style file with coordinates for d5tnc__.
(The format of our PDB-style files is described here.)

Timeline for d5tnc__: