Class a: All alpha proteins [46456] (218 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Troponin C [47503] (6 species) |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [47505] (2 PDB entries) |
Domain d5tnc__: 5tnc - [17246] |
PDB Entry: 5tnc (more details), 2 Å
SCOP Domain Sequences for d5tnc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tnc__ a.39.1.5 (-) Troponin C {Turkey (Meleagris gallopavo)} smtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldai ieevdedgsgtidfeeflvmmvrqmkedakgkseeeledcfrifdknadgfidieelgei lratgehvteediedlmkdsdknndgridfdeflkmmegvq
Timeline for d5tnc__: