Lineage for d5tnca_ (5tnc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711123Protein Troponin C [47503] (6 species)
  7. 2711200Species Turkey (Meleagris gallopavo) [TaxId:9103] [47505] (2 PDB entries)
  8. 2711201Domain d5tnca_: 5tnc A: [17246]
    complexed with ca

Details for d5tnca_

PDB Entry: 5tnc (more details), 2 Å

PDB Description: refined crystal structure of troponin c from turkey skeletal muscle at 2.0 angstroms resolution
PDB Compounds: (A:) troponin-c

SCOPe Domain Sequences for d5tnca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tnca_ a.39.1.5 (A:) Troponin C {Turkey (Meleagris gallopavo) [TaxId: 9103]}
smtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldai
ieevdedgsgtidfeeflvmmvrqmkedakgkseeeledcfrifdknadgfidieelgei
lratgehvteediedlmkdsdknndgridfdeflkmmegvq

SCOPe Domain Coordinates for d5tnca_:

Click to download the PDB-style file with coordinates for d5tnca_.
(The format of our PDB-style files is described here.)

Timeline for d5tnca_: