Lineage for d1blqa_ (1blq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997314Protein Troponin C [47503] (6 species)
  7. 1997315Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1997345Domain d1blqa_: 1blq A: [17240]
    N-domain only

Details for d1blqa_

PDB Entry: 1blq (more details)

PDB Description: structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures
PDB Compounds: (A:) n-troponin c

SCOPe Domain Sequences for d1blqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blqa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

SCOPe Domain Coordinates for d1blqa_:

Click to download the PDB-style file with coordinates for d1blqa_.
(The format of our PDB-style files is described here.)

Timeline for d1blqa_: