Lineage for d3av8d_ (3av8 D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018450Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1018558Protein automated matches [190231] (6 species)
    not a true protein
  7. 1018559Species Aphanothece sacrum [TaxId:1122] [189862] (1 PDB entry)
  8. 1018563Domain d3av8d_: 3av8 D: [172351]
    automated match to d1fxia_
    complexed with fes, so4

Details for d3av8d_

PDB Entry: 3av8 (more details), 1.46 Å

PDB Description: Refined Structure of Plant-type [2Fe-2S] Ferredoxin I from Aphanothece sacrum at 1.46 A Resolution
PDB Compounds: (D:) Ferredoxin-1

SCOPe Domain Sequences for d3av8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3av8d_ d.15.4.1 (D:) automated matches {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
dqsfldddqiqagyiltcvayptgdcviethkeealy

SCOPe Domain Coordinates for d3av8d_:

Click to download the PDB-style file with coordinates for d3av8d_.
(The format of our PDB-style files is described here.)

Timeline for d3av8d_: