SCOPe 2.02: Domain d3av8b_: 3av8 B:

Lineage for d3av8b_ (3av8 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (7 species)
   not a true protein

7. Species Aphanothece sacrum [TaxId:1122] [189862] (1 PDB entry)

8. Domain d3av8b_: 3av8 B: [172349]
   automated match to d1fxia_
   complexed with fes, so4

Details for d3av8b_

PDB Entry: 3av8, 1.46 Å

PDB Description: Refined Structure of Plant-type [2Fe-2S] Ferredoxin I from Aphanothece sacrum at 1.46 A Resolution

PDB Compounds: (B:) Ferredoxin-1

SCOPe Domain Sequences for d3av8b_:

Sequence; same for both SEQRES and ATOM records:

>d3av8b_ d.15.4.1 (B:) automated matches {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
dqsfldddqiqagyiltcvayptgdcviethkeealy

Timeline for d3av8b_:

• d3av8b_ first appeared in SCOPe 2.01
  
• d3av8b_ appears in SCOPe 2.03
  
• d3av8b_ appears in the current release, SCOPe 2.08