Lineage for d1smg__ (1smg -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (16 proteins) 
Protein Troponin C [47503] (5 species) Species Chicken (Gallus gallus) [TaxId:9031] [47504] (22 PDB entries) 
Domain d1smg__: 1smg - [17234]
Details for d1smg__
PDB Entry: 1smg (more details)
PDB Description: calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures
SCOP Domain Sequences for d1smg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smg__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkalgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda
SCOP Domain Coordinates for d1smg__:
Click to download the PDB-style file with coordinates for d1smg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1smg__:
- d1smg__ first appeared (with stable ids) in SCOP 1.55
- d1smg__ appears in SCOP 1.59
- d1smg__ appears in SCOP 1.63
- d1smg__ appears in the current release, SCOPe 2.08, called d1smga_
View in 3D