Lineage for d1smg__ (1smg -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152578Family a.39.1.5: Calmodulin-like [47502] (16 proteins)
  6. 152722Protein Troponin C [47503] (5 species)
  7. 152723Species Chicken (Gallus gallus) [TaxId:9031] [47504] (22 PDB entries)
  8. 152736Domain d1smg__: 1smg - [17234]

Details for d1smg__

PDB Entry: 1smg (more details)

PDB Description: calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures

SCOP Domain Sequences for d1smg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smg__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkalgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

SCOP Domain Coordinates for d1smg__:

Click to download the PDB-style file with coordinates for d1smg__.
(The format of our PDB-style files is described here.)

Timeline for d1smg__: