![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
![]() | Superfamily f.6.1: Leukocidin-like [56959] (2 families) ![]() |
![]() | Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit |
![]() | Protein automated matches [190904] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [189747] (2 PDB entries) |
![]() | Domain d3anzq_: 3anz Q: [172269] automated match to d7ahla_ complexed with acy, mpd |
PDB Entry: 3anz (more details), 2.3 Å
SCOPe Domain Sequences for d3anzq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3anzq_ f.6.1.1 (Q:) automated matches {Staphylococcus aureus [TaxId: 158878]} adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtnl
Timeline for d3anzq_: