| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
| Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
| Protein automated matches [190904] (2 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [189747] (2 PDB entries) |
| Domain d3anzk_: 3anz K: [172263] automated match to d7ahla_ complexed with acy, mpd |
PDB Entry: 3anz (more details), 2.3 Å
SCOPe Domain Sequences for d3anzk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3anzk_ f.6.1.1 (K:) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtnle
Timeline for d3anzk_: