Lineage for d3anza_ (3anz A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455550Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1455551Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 1455552Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 1455608Protein automated matches [190904] (2 species)
    not a true protein
  7. 1455609Species Staphylococcus aureus [TaxId:158878] [189747] (2 PDB entries)
  8. 1455610Domain d3anza_: 3anz A: [172253]
    automated match to d7ahla_
    complexed with acy, mpd

Details for d3anza_

PDB Entry: 3anz (more details), 2.3 Å

PDB Description: crystal structure of alpha-hemolysin
PDB Compounds: (A:) alpha-hemolysin

SCOPe Domain Sequences for d3anza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3anza_ f.6.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtnle

SCOPe Domain Coordinates for d3anza_:

Click to download the PDB-style file with coordinates for d3anza_.
(The format of our PDB-style files is described here.)

Timeline for d3anza_: