SCOPe 2.01: Domain d3alda_: 3ald A:

Lineage for d3alda_ (3ald A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)

6. Protein automated matches [190195] (3 species)
   not a true protein

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (24 PDB entries)

8. Domain d3alda_: 3ald A: [172236]
   automated match to d1thva_
   complexed with gol, tla

Details for d3alda_

PDB Entry: 3ald, 1.1 Å

PDB Description: Crystal structure of sweet-tasting protein Thaumatin I at 1.10 A

PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d3alda_:

Sequence; same for both SEQRES and ATOM records:

>d3alda_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d3alda_:

• d3alda_ is new in SCOPe 2.01-stable
  
• d3alda_ appears in SCOPe 2.02
  
• d3alda_ appears in the current release, SCOPe 2.08