SCOPe 2.01: Domain d3al4e_: 3al4 E:

Lineage for d3al4e_ (3al4 E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (5 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries)

8. Domain d3al4e_: 3al4 E: [172227]
   automated match to d1ruyh_
   complexed with nag

Details for d3al4e_

PDB Entry: 3al4, 2.87 Å

PDB Description: crystal structure of the swine-origin a (h1n1)-2009 influenza a virus hemagglutinin (ha) reveals similar antigenicity to that of the 1918 pandemic virus

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d3al4e_:

Sequence; same for both SEQRES and ATOM records:

>d3al4e_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrni

Timeline for d3al4e_:

• d3al4e_ is new in SCOPe 2.01-stable
  
• d3al4e_ appears in SCOPe 2.02
  
• d3al4e_ appears in the current release, SCOPe 2.08