Lineage for d1rtp3_ (1rtp 3:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152540Family a.39.1.4: Parvalbumin [47492] (2 proteins)
  6. 152545Protein Parvalbumin [47495] (6 species)
  7. 152568Species Rat (Rattus rattus) [TaxId:10117] [47501] (2 PDB entries)
  8. 152572Domain d1rtp3_: 1rtp 3: [17221]

Details for d1rtp3_

PDB Entry: 1rtp (more details), 2 Å

PDB Description: refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution

SCOP Domain Sequences for d1rtp3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtp3_ a.39.1.4 (3:) Parvalbumin {Rat (Rattus rattus)}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOP Domain Coordinates for d1rtp3_:

Click to download the PDB-style file with coordinates for d1rtp3_.
(The format of our PDB-style files is described here.)

Timeline for d1rtp3_: