Lineage for d1bu3__ (1bu3 -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.4: Parvalbumin [47492] (2 proteins) Protein Parvalbumin [47495] (6 species) 
Species Silver hake (Merluccius bilinearis) [TaxId:79698] [47500] (1 PDB entry) 
Domain d1bu3__: 1bu3 - [17218]
Details for d1bu3__
PDB Entry: 1bu3 (more details), 1.65 Å
PDB Description: refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
SCOP Domain Sequences for d1bu3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bu3__ a.39.1.4 (-) Parvalbumin {Silver hake (Merluccius bilinearis)}
afsgiladadvaaalkaceaadsfnykaffakvgltaksaddikkaffvidqdksgfiee
delklflqvfsagaraltdaetkaflkagdsdgdgaigvdewaalvka
SCOP Domain Coordinates for d1bu3__:
Click to download the PDB-style file with coordinates for d1bu3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bu3__:
- d1bu3__ first appeared (with stable ids) in SCOP 1.55
- d1bu3__ appears in SCOP 1.59
- d1bu3__ appears in SCOP 1.63
- d1bu3__ appears in the current release, SCOPe 2.08, called d1bu3a_
View in 3D