Lineage for d3ah6c_ (3ah6 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651375Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 1651376Protein Cut A1 [89931] (5 species)
  7. 1651379Species Escherichia coli [TaxId:562] [102973] (4 PDB entries)
  8. 1651394Domain d3ah6c_: 3ah6 C: [172172]
    automated match to d1naqa_

Details for d3ah6c_

PDB Entry: 3ah6 (more details), 2.4 Å

PDB Description: Remarkable improvement of the heat stability of CutA1 from E.coli by rational protein designing
PDB Compounds: (C:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3ah6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah6c_ d.58.5.2 (C:) Cut A1 {Escherichia coli [TaxId: 562]}
sntavvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmil
kttvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl

SCOPe Domain Coordinates for d3ah6c_:

Click to download the PDB-style file with coordinates for d3ah6c_.
(The format of our PDB-style files is described here.)

Timeline for d3ah6c_: