SCOPe 2.08: Domain d3ah4b2: 3ah4 B:149-286

Lineage for d3ah4b2 (3ah4 B:149-286)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Hemagglutinin component Ha1 [101784] (2 species)

7. Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries)

8. Domain d3ah4b2: 3ah4 B:149-286 [172169]
   automated match to d1qxma2
   complexed with gal

Details for d3ah4b2

PDB Entry: 3ah4, 1.78 Å

PDB Description: ha1 subcomponent of botulinum type c progenitor toxin complexed with galactose

PDB Compounds: (B:) Main hemagglutinin component

SCOPe Domain Sequences for d3ah4b2:

Sequence; same for both SEQRES and ATOM records:

>d3ah4b2 b.42.2.1 (B:149-286) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]}
nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryl
twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqiangthv
ivdsyhgntnqqwiinli

Timeline for d3ah4b2:

• d3ah4b2 first appeared in SCOPe 2.01
  
• d3ah4b2 appears in SCOPe 2.07