SCOPe 2.08: Domain d3ag1u_: 3ag1 U:

Lineage for d3ag1u_ (3ag1 U:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein automated matches [190271] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries)

8. Domain d3ag1u_: 3ag1 U: [172062]
   Other proteins in same PDB: d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
   automated match to d1ocrh_
   complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1u_

PDB Entry: 3ag1, 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K

PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3ag1u_:

Sequence; same for both SEQRES and ATOM records:

>d3ag1u_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d3ag1u_:

• d3ag1u_ first appeared in SCOPe 2.01
  
• d3ag1u_ appears in SCOPe 2.07