Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
Species Cow (Bos taurus) [TaxId:9913] [81408] (23 PDB entries) |
Domain d3ag1g_: 3ag1 G: [172049] Other proteins in same PDB: d3ag1a_, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_ automated match to d1occg_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag1 (more details), 2.2 Å
SCOPe Domain Sequences for d3ag1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag1g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d3ag1g_: