SCOPe 2.08: Domain d3afma_: 3afm A:

Lineage for d3afma_ (3afm A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Sphingomonas sp. [TaxId:90322] [189409] (6 PDB entries)

8. Domain d3afma_: 3afm A: [172036]
   automated match to d1spxa_

Details for d3afma_

PDB Entry: 3afm, 1.65 Å

PDB Description: Crystal structure of aldose reductase A1-R responsible for alginate metabolism

PDB Compounds: (A:) carbonyl reductase

SCOPe Domain Sequences for d3afma_:

Sequence; same for both SEQRES and ATOM records:

>d3afma_ c.2.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
mfpdlkgkrvlitgssqgiglatarlfaragakvglhgrkapanidetiasmradggdaa
ffaadlatseacqqlvdefvakfggidvlinnagglvgrkplpeiddtfydavmdanirs
vvmttkfalphlaaaakasgqtsavistgsiaghtgggpgaglygaakaflhnvhknwvd
fhtkdgvrfnivspgtvdtafhadktqdvrdrisngipmgrfgtaeemapaflffashla
sgyitgqvldinggqykh

Timeline for d3afma_:

• d3afma_ first appeared in SCOPe 2.01
  
• d3afma_ appears in SCOPe 2.07