Lineage for d3adea_ (3ade A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 960183Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 960184Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 960193Protein automated matches [190126] (1 species)
    not a true protein
  7. 960194Species Mouse (Mus musculus) [TaxId:10090] [186850] (3 PDB entries)
  8. 960197Domain d3adea_: 3ade A: [172009]
    automated match to d1x2ja1
    complexed with so4

Details for d3adea_

PDB Entry: 3ade (more details), 2.8 Å

PDB Description: Crystal Structure of Keap1 in Complex with Sequestosome-1/p62
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d3adea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3adea_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmn
tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhqg
kiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc

SCOPe Domain Coordinates for d3adea_:

Click to download the PDB-style file with coordinates for d3adea_.
(The format of our PDB-style files is described here.)

Timeline for d3adea_: