Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) automatically mapped to Pfam PF02936 |
Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
Protein automated matches [190270] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187062] (18 PDB entries) |
Domain d3abkd_: 3abk D: [171924] Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ automated match to d1occd_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3abk (more details), 2 Å
SCOPe Domain Sequences for d3abkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abkd_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d3abkd_:
View in 3D Domains from other chains: (mouse over for more information) d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ |