SCOPe 2.05: Domain d3aaac_: 3aaa C:

Lineage for d3aaac_ (3aaa C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (6 PDB entries)

8. Domain d3aaac_: 3aaa C: [171906]
   Other proteins in same PDB: d3aaaa_, d3aaab_
   automated match to d1myoa_
   complexed with ipa

Details for d3aaac_

PDB Entry: 3aaa, 2.2 Å

PDB Description: Crystal Structure of Actin capping protein in complex with V-1

PDB Compounds: (C:) myotrophin

SCOPe Domain Sequences for d3aaac_:

Sequence; same for both SEQRES and ATOM records:

>d3aaac_ d.211.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgadi
napdkhhitpllsavyeghvscvklllskgadktvkgpdgltafeatdnqaikallq

Timeline for d3aaac_:

• d3aaac_ first appeared in SCOPe 2.01
  
• d3aaac_ appears in SCOPe 2.04
  
• d3aaac_ appears in SCOPe 2.06
  
• d3aaac_ appears in the current release, SCOPe 2.08