Lineage for d3aaac_ (3aaa C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685843Species Human (Homo sapiens) [TaxId:9606] [187689] (7 PDB entries)
  8. 1685852Domain d3aaac_: 3aaa C: [171906]
    Other proteins in same PDB: d3aaaa_, d3aaab_
    automated match to d1myoa_
    complexed with ipa

Details for d3aaac_

PDB Entry: 3aaa (more details), 2.2 Å

PDB Description: Crystal Structure of Actin capping protein in complex with V-1
PDB Compounds: (C:) myotrophin

SCOPe Domain Sequences for d3aaac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aaac_ d.211.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgadi
napdkhhitpllsavyeghvscvklllskgadktvkgpdgltafeatdnqaikallq

SCOPe Domain Coordinates for d3aaac_:

Click to download the PDB-style file with coordinates for d3aaac_.
(The format of our PDB-style files is described here.)

Timeline for d3aaac_: