Lineage for d3a8kf_ (3a8k F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332006Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1332007Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 1332051Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 1332052Species Escherichia coli K-12 [TaxId:83333] [189182] (5 PDB entries)
  8. 1332056Domain d3a8kf_: 3a8k F: [171876]
    Other proteins in same PDB: d3a8ka1, d3a8ka2, d3a8kb1, d3a8kb2, d3a8kc1, d3a8kc2, d3a8kd1, d3a8kd2
    automated match to d1onla_

Details for d3a8kf_

PDB Entry: 3a8k (more details), 1.95 Å

PDB Description: crystal structure of etd97n-ehred complex
PDB Compounds: (F:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8kf_ b.84.1.1 (F:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
ealled

SCOPe Domain Coordinates for d3a8kf_:

Click to download the PDB-style file with coordinates for d3a8kf_.
(The format of our PDB-style files is described here.)

Timeline for d3a8kf_: