SCOPe 2.01: Domain d3a8kf_: 3a8k F:

Lineage for d3a8kf_ (3a8k F:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein automated matches [191146] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189293] (3 PDB entries)

8. Domain d3a8kf_: 3a8k F: [171876]
   automated match to d1onla_

Details for d3a8kf_

PDB Entry: 3a8k, 1.95 Å

PDB Description: crystal structure of etd97n-ehred complex

PDB Compounds: (F:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8kf_:

Sequence; same for both SEQRES and ATOM records:

>d3a8kf_ b.84.1.1 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
ealled

Timeline for d3a8kf_:

• d3a8kf_ is new in SCOPe 2.01-stable
  
• d3a8kf_ appears in SCOPe 2.02
  
• d3a8kf_ appears in the current release, SCOPe 2.08