![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein FMN-binding protein [50477] (1 species) |
![]() | Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (11 PDB entries) |
![]() | Domain d3a6qb_: 3a6q B: [171830] automated match to d1axja_ complexed with cl, fmn; mutant |
PDB Entry: 3a6q (more details), 1.4 Å
SCOPe Domain Sequences for d3a6qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a6qb_ b.45.1.1 (B:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]} mlpgtffevlkntgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq tl
Timeline for d3a6qb_: