Lineage for d3a6ge_ (3a6g E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1189314Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1189315Superfamily c.125.1: Creatininase [102215] (1 family) (S)
  5. 1189316Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 1189317Protein Creatininase [102217] (1 species)
  7. 1189318Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 1189365Domain d3a6ge_: 3a6g E: [171798]
    automated match to d1j2ta_
    complexed with mn, zn; mutant

Details for d3a6ge_

PDB Entry: 3a6g (more details), 2 Å

PDB Description: w154f mutant creatininase
PDB Compounds: (E:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6ge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6ge_ c.125.1.1 (E:) Creatininase {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsyfdfvkdpaviqqlypegflgwdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6ge_:

Click to download the PDB-style file with coordinates for d3a6ge_.
(The format of our PDB-style files is described here.)

Timeline for d3a6ge_: