Lineage for d3a6db_ (3a6d B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529985Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2529986Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2529987Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 2529988Protein Creatininase [102217] (1 species)
  7. 2529989Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2530009Domain d3a6db_: 3a6d B: [171777]
    automated match to d1j2ta_
    complexed with mgx, mn, so4, zn

Details for d3a6db_

PDB Entry: 3a6d (more details), 1.9 Å

PDB Description: Creatininase complexed with 1-methylguanidine
PDB Compounds: (B:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6db_ c.125.1.1 (B:) Creatininase {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyen
smfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvfe
tslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelile
vcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6db_:

Click to download the PDB-style file with coordinates for d3a6db_.
(The format of our PDB-style files is described here.)

Timeline for d3a6db_: