Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (20 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [186846] (19 PDB entries) |
Domain d3a5wj_: 3a5w J: [171769] automated match to d1x0ra1 |
PDB Entry: 3a5w (more details), 2.2 Å
SCOPe Domain Sequences for d3a5wj_:
Sequence, based on SEQRES records: (download)
>d3a5wj_ c.47.1.10 (J:) automated matches {Aeropyrum pernix [TaxId: 272557]} pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll yee
>d3a5wj_ c.47.1.10 (J:) automated matches {Aeropyrum pernix [TaxId: 272557]} pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaath tvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiige glivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakllye e
Timeline for d3a5wj_: