SCOPe 2.01: Domain d3a3ia_: 3a3i A:

Lineage for d3a3ia_ (3a3i A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.3: Dac-like [144040] (3 proteins)
   Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology

6. Protein DD-carboxypeptidase DacB [144045] (2 species)
   Penicillin-binding protein 4

7. Species Haemophilus influenzae [TaxId:727] [189139] (4 PDB entries)

8. Domain d3a3ia_: 3a3i A: [171703]
   automated match to d2ex2a1
   complexed with aix

Details for d3a3ia_

PDB Entry: 3a3i, 2 Å

PDB Description: Crystal structure of penicillin binding protein 4 (dacB) from Haemophilus influenzae, complexed with ampicillin (AIX)

PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3a3ia_:

Sequence; same for both SEQRES and ATOM records:

>d3a3ia_ e.3.1.3 (A:) DD-carboxypeptidase DacB {Haemophilus influenzae [TaxId: 727]}
minvsdltqklpegsnagviakninqnqiiadyngstfmlpastqkvftavaaklalgdq
fqfetallsngkiqngnldgnlivsftgdpdltrgqlysllaelkkqgikkingdlvldt
svfsshdrglgwiwndltmcfnsppaaanidnncfyaeldanknpgeivkinvpaqfpiq
vfgqvyvadsneapycqldvvvhdnnryqvkgclarqykpfglsfavqntdayaaaiiqr
qlrklgiefngkvllpqkpqqgqllakhlskplpdllkkmmkksdnqiadslfravafny
ykrpasfqlgtlavksilqkqgirfgnsiladgsglsrhnlvapktmlsvleyiaknedk
lhlmetfpiagvdgtisgrgglispplvknviaktgslkgvynlagfmtnargekvafvq
fingystgdlesktkraplvqfernlynelyky

Timeline for d3a3ia_:

• d3a3ia_ is new in SCOPe 2.01-stable
  
• d3a3ia_ appears in SCOPe 2.02
  
• d3a3ia_ appears in the current release, SCOPe 2.08, called d3a3ia1