Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.3: Dac-like [144040] (3 proteins) Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology |
Protein DD-carboxypeptidase DacB [144045] (2 species) Penicillin-binding protein 4 |
Species Haemophilus influenzae [TaxId:727] [189139] (4 PDB entries) |
Domain d3a3fa1: 3a3f A:28-479 [171701] Other proteins in same PDB: d3a3fa2, d3a3fb2 automated match to d2ex2a1 complexed with fmz |
PDB Entry: 3a3f (more details), 2.1 Å
SCOPe Domain Sequences for d3a3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a3fa1 e.3.1.3 (A:28-479) DD-carboxypeptidase DacB {Haemophilus influenzae [TaxId: 727]} invsdltqklpegsnagviakninqnqiiadyngstfmlpastqkvftavaaklalgdqf qfetallsngkiqngnldgnlivsftgdpdltrgqlysllaelkkqgikkingdlvldts vfsshdrglgwiwndltmcfnsppaaanidnncfyaeldanknpgeivkinvpaqfpiqv fgqvyvadsneapycqldvvvhdnnryqvkgclarqykpfglsfavqntdayaaaiiqrq lrklgiefngkvllpqkpqqgqllakhlskplpdllkkmmkksdnqiadslfravafnyy krpasfqlgtlavksilqkqgirfgnsiladgsglsrhnlvapktmlsvleyiaknedkl hlmetfpiagvdgtisgrgglispplvknviaktgslkgvynlagfmtnargekvafvqf ingystgdlesktkraplvqfernlynelyky
Timeline for d3a3fa1: