![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
![]() | Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) ![]() |
![]() | Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
![]() | Protein automated matches [190587] (7 species) not a true protein |
![]() | Species Polygonatum cyrtonema [TaxId:195526] [189271] (3 PDB entries) |
![]() | Domain d3a0ea_: 3a0e A: [171629] automated match to d1jpca_ complexed with m3m, so4 |
PDB Entry: 3a0e (more details), 2 Å
SCOPe Domain Sequences for d3a0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0ea_ b.78.1.0 (A:) automated matches {Polygonatum cyrtonema [TaxId: 195526]} vnslsspnslftghslevgpsyrlimqgdcnfvlydsgkpvwasntgglgsgcrltlhnn gnlviydqsnrviwqtktngkedhyvlvlqqdrnvviygpvvwatgsgpa
Timeline for d3a0ea_: