| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Aquifex aeolicus [TaxId:63363] [189042] (1 PDB entry) |
| Domain d2zxya_: 2zxy A: [171602] automated match to d1cora_ complexed with hec |
PDB Entry: 2zxy (more details), 1.15 Å
SCOPe Domain Sequences for d2zxya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxya_ a.3.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
mkpqltmlkglsdaelkaladfilsh
Timeline for d2zxya_: