SCOPe 2.07: Domain d2zxwt_: 2zxw T:

Lineage for d2zxwt_ (2zxw T:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries)

8. Domain d2zxwt_: 2zxw T: [171589]
   Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
   automated match to d1occg_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwt_

PDB Entry: 2zxw, 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)

PDB Compounds: (T:) cytochrome c oxidase polypeptide 6a2

SCOPe Domain Sequences for d2zxwt_:

Sequence; same for both SEQRES and ATOM records:

>d2zxwt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2zxwt_:

• d2zxwt_ first appeared in SCOPe 2.01
  
• d2zxwt_ appears in SCOPe 2.06
  
• d2zxwt_ appears in the current release, SCOPe 2.08