SCOPe 2.04: Domain d2zxvb_: 2zxv B:

Lineage for d2zxvb_ (2zxv B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188268] (2 PDB entries)

8. Domain d2zxvb_: 2zxv B: [171569]
   automated match to d1yrea1

Details for d2zxvb_

PDB Entry: 2zxv, 2.3 Å

PDB Description: Crystal structure of putative acetyltransferase from T. thermophilus HB8

PDB Compounds: (B:) Putative uncharacterized protein TTHA1799

SCOPe Domain Sequences for d2zxvb_:

Sequence; same for both SEQRES and ATOM records:

>d2zxvb_ d.108.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
arlearly

Timeline for d2zxvb_:

• d2zxvb_ first appeared in SCOPe 2.01
  
• d2zxvb_ appears in SCOPe 2.03
  
• d2zxvb_ appears in SCOPe 2.05
  
• d2zxvb_ appears in the current release, SCOPe 2.08