Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein automated matches [190177] (9 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189041] (1 PDB entry) |
Domain d2zwmb_: 2zwm B: [171564] automated match to d1nxoa_ complexed with so4 |
PDB Entry: 2zwm (more details), 2.04 Å
SCOPe Domain Sequences for d2zwmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwmb_ c.23.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} dkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkdg vevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrql
Timeline for d2zwmb_: