Lineage for d2ztxa_ (2ztx A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407199Species Human coxsackievirus B3 [TaxId:12072] [188738] (7 PDB entries)
  8. 2407203Domain d2ztxa_: 2ztx A: [171519]
    automated match to d1l1na_
    complexed with dtz

Details for d2ztxa_

PDB Entry: 2ztx (more details), 1.72 Å

PDB Description: Complex structure of CVB3 3C protease with EPDTC
PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d2ztxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ztxa_ b.47.1.4 (A:) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d2ztxa_:

Click to download the PDB-style file with coordinates for d2ztxa_.
(The format of our PDB-style files is described here.)

Timeline for d2ztxa_: