Lineage for d2ztha_ (2zth A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892847Protein automated matches [190251] (6 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (8 PDB entries)
  8. 2892878Domain d2ztha_: 2zth A: [171501]
    automated match to d1h1da_
    complexed with mg, sam

Details for d2ztha_

PDB Entry: 2zth (more details), 2.6 Å

PDB Description: Crystal structure of holo form of rat catechol-o-methyltransferase
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d2ztha_:

Sequence, based on SEQRES records: (download)

>d2ztha_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqg

Sequence, based on observed residues (ATOM records): (download)

>d2ztha_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqvgdakgqimdavireyspslvlelgay
cgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdlipqlkk
kydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayvrgsss
fecthyssyleymkvvdglekaiyqg

SCOPe Domain Coordinates for d2ztha_:

Click to download the PDB-style file with coordinates for d2ztha_.
(The format of our PDB-style files is described here.)

Timeline for d2ztha_: